PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.0631s0100.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family Dof
Protein Properties Length: 372aa    MW: 40454.8 Da    PI: 6.2493
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.0631s0100.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.28.8e-39100159261
                  zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61 
                             ++k+l+cprC+s +tkfCy+nny+++qPr+fCk+C+ryWt+GG++rnvP+G+grrknk+ 
  SapurV1A.0631s0100.2.p 100 PDKILPCPRCNSLDTKFCYFNNYNVNQPRHFCKNCQRYWTAGGTVRNVPIGAGRRKNKHL 159
                             7899*****************************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074781.0E-2993157IPR003851Zinc finger, Dof-type
PfamPF027015.4E-32102158IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.574104158IPR003851Zinc finger, Dof-type
PROSITE patternPS013610106142IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 372 aa     Download sequence    Send to blast
MKGDSKDPAF KLFGRQIPVP DTQFPAETLA KGSCGDITKL ETKGPSEENS EKPEILSVLG  60
QGEEEMPAAM QVNETEVIAK PMEGQLEANG TDKERVFKKP DKILPCPRCN SLDTKFCYFN  120
NYNVNQPRHF CKNCQRYWTA GGTVRNVPIG AGRRKNKHLA TQYRQILVSS DGMPIARMEN  180
SDSAGHQLPS SVESATTLRP STTNGMVLKF GPEAPLCDSM ETVLNLGDPK RYEMSSVNYQ  240
DNGEEPPSCG SSKAASIVRE NELPENITKE QVDLPASSNN LGAPHSLHCY PVPSWVFPRN  300
PAWNNVTSMA AAQHSSGQAC ITNVPTQVQL CPTPMVAVPS ICPLNIPLQF VPASYWGCMP  360
TWTAGTGNVP L*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002325441.10.0hypothetical protein POPTR_0019s05720g
TrEMBLB9IPV30.0B9IPV3_POPTR; Uncharacterized protein
STRINGPOPTR_0019s05720.10.0(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.14e-44cycling DOF factor 3